Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,757 results found for hug

lovehug friendsfamilyfriendshandshakehappycouple hugsadsmilehug silhouette
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Rear view of adult daughter hugging happy senior mother indoors at home.

Embracing Love: Real Emotions, Positive Atmosphere

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

Close-up of woman giving a warm hug to a man outdoors

Couple is hugging. Hands of man and woman. Give more hugs.

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

Happy couple hugging in the city, slow motion, shot at 60fps

Portrait of couple hands, sitting on sofa at home in the living room.

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

Medium Shot - Two men greet and hug each other at a park - shot on RED

Couple embracing after conflict, showing support and forgiveness in living room

A Joyful Evening on the Beach: Couple Embracing

Medium close-up shot of two young people hugging each other and gently whispering to one another

Loving couple sharing affectionate moment while strolling together

Senior couple hugging in the city during sunset, 120fps

Mother with a crying daughter sitting on the grass and mom comforting daughter

Sunset Silhouette of Couple Embracing at Beach

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Close-up. Couple in love on the city embankment. A happy woman tenderly hugs her lover. The woman looks at the camera.

Loving couple embracing outdoors

Couple at the meadow

Medium shot of barefoot baby making first steps, walking towards happily smiling mother and hugging her in kids room at home

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

Group of Young People Embrace

Girl hugging a guy, close-up of hands interlocking on the back of a boyfriend

Father hugs his son on the field at sunset. Slowmo

Loving couple embracing at home

Close up of happy senior woman getting gift from friend during celebration outdoors on patio

Sweet Moment: Young Girl Embraces Grandmother with a Smile

Mother With a Child on Nature

Family enjoying autumn walk in the park. Slow motion.

Loving couple sharing affectionate moment while strolling together

The couple standing against a starry sky with a northern light. time lapse

Mother and daughter share a tender moment, appreciating the stunning sunset.

Medium shot of two senior men in hats standing in pedestrian street on warm day, hugging each other and patting on the shoulders

Two Female Friends greeting each other with a Hug Outdoors

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

A Couple Embraces in a Stunning Sunset

Supportive Boyfriend Comforts Young Woman

Two happy women hug each other when meeting after long separation. Slow motion

Couple Greeting Each Other With Hug As They Meet In Coffee Shop

Dad cherishes quality time with his beloved daughters. A heartwarming family moment.

Reunion of diverse friends in apartment, smiling and talking

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Happy couple embracing

Boy tightly embracing his mother